PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g22970
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 216aa    MW: 25033.2 Da    PI: 5.2617
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g22970genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.46.8e-2057109456
                 -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 ++++++eq++ Le+ F  ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  CA02g22970  57 KRKLSEEQVNLLEQSFGDEHKLESERKDKLAAELGLDPRQVAVWFQNRRARWK 109
                 45899***********************************************9 PP

2HD-ZIP_I/II120.77.7e-3956147293
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  +kr+ls+eqv+lLE+sF  e+kLe+erK +la eLgl+prqvavWFqnrRAR+k+k+lE++y++Lk+++d+ + +++rLe+ev +L+e+l+e
   CA02g22970  56 RKRKLSEEQVNLLEQSFGDEHKLESERKDKLAAELGLDPRQVAVWFQNRRARWKSKKLEEEYSKLKSEHDNNVVDKCRLETEVLKLKEQLSE 147
                  8****************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.97351111IPR001356Homeobox domain
SMARTSM003896.9E-2054115IPR001356Homeobox domain
CDDcd000868.53E-1756112No hitNo description
SuperFamilySSF466897.27E-1857120IPR009057Homeodomain-like
PfamPF000465.1E-1757109IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-2058118IPR009057Homeodomain-like
PRINTSPR000315.9E-68291IPR000047Helix-turn-helix motif
PROSITE patternPS00027086109IPR017970Homeobox, conserved site
PRINTSPR000315.9E-691107IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MNHHQVAEDE MVLINQYYPG IYTQLAPQQG ESKPRRRRKK NKLGEGSGSD QAMMMRKRKL  60
SEEQVNLLEQ SFGDEHKLES ERKDKLAAEL GLDPRQVAVW FQNRRARWKS KKLEEEYSKL  120
KSEHDNNVVD KCRLETEVLK LKEQLSEAEK EIQRLLFERC DGVSSNTSPS ASSFSMEAAM  180
EPPYLGEFGM EGMDDMFYGQ ENNYVQGLDW VNLYI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13758RKKNKLGEGSGSDQAMMMRKRK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2260011e-104AC226001.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02HBa0116F10, complete sequence.
GenBankHG9755141e-104HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016560578.11e-160PREDICTED: homeobox-leucine zipper protein ATHB-40
SwissprotO232081e-73ATB40_ARATH; Homeobox-leucine zipper protein ATHB-40
SwissprotQ9ZU701e-73ATB21_ARATH; Homeobox-leucine zipper protein ATHB-21
TrEMBLK4BB741e-128K4BB74_SOLLC; Uncharacterized protein
STRINGSolyc02g085630.2.11e-128(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12892480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.14e-63homeobox protein 40